PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr010210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 334aa    MW: 37239.4 Da    PI: 4.8423
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr010210.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.79.6e-171360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l++ ++ +G g+W+++++  g+ R++k+c++rw +yl
      Pbr010210.1 13 RGLWSPEEDEKLLNHINTYGHGSWSSVPQLAGLERCGKSCRLRWINYL 60
                     788*******************************************97 PP

2Myb_DNA-binding46.21.1e-1466109146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++++ E+  +v++++ lG++ W+ Ia++++ gRt++++k++w++
      Pbr010210.1  66 RGSFSEIEERTIVEVHRILGNK-WAQIAKHLP-GRTDNEVKNFWNS 109
                      899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.1E-26563IPR009057Homeodomain-like
PROSITE profilePS5129416.821860IPR017930Myb domain
SuperFamilySSF466893.03E-2910107IPR009057Homeodomain-like
SMARTSM007172.3E-131262IPR001005SANT/Myb domain
PfamPF002492.3E-151360IPR001005SANT/Myb domain
CDDcd001671.62E-111660No hitNo description
PROSITE profilePS5129424.41361115IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.3E-2464116IPR009057Homeodomain-like
SMARTSM007171.6E-1465113IPR001005SANT/Myb domain
PfamPF002491.4E-1366109IPR001005SANT/Myb domain
CDDcd001678.84E-1168108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MGHNCCSKQK VKRGLWSPEE DEKLLNHINT YGHGSWSSVP QLAGLERCGK SCRLRWINYL  60
RPDLKRGSFS EIEERTIVEV HRILGNKWAQ IAKHLPGRTD NEVKNFWNSC IKKKLIAQGF  120
DPNTHNLLPS SKANPSNIIN NNNNNNNIHA CNMFSPSSVF SVNSSHVSAD TSIDILEAPY  180
LTLPSTSSPN ANHESSTIST YEFQNPNIVW STTPVQEQIN PIFLPESMGI NSVPTISTSH  240
SYPISELENI VNESFQPITK STNPEDIQLQ SQQEEACEVV EDEEANGLDG AQTNMDVSFG  300
SSNFDMDFME STVLPCGMYN YQLSPMDQLA WNG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-31131157108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009368560.10.0PREDICTED: transcription factor MYB86-like
TrEMBLM5WLA01e-140M5WLA0_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s12240.11e-108(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34663267
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.15e-82myb domain protein 67